PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05887A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 475aa    MW: 52411.5 Da    PI: 6.7934
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05887AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.66.1e-13167210447
                                S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                WTt E+ l++++   +G g Wk I+r++ k+Rt+ q+ s+ qky
  Oropetium_20150105_05887A 167 WTTKEHRLFLRGLSVYGRGKWKDISRYFVKTRTAVQVSSHAQKY 210
                                *******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.997159215IPR017930Myb domain
SuperFamilySSF466892.96E-15162215IPR009057Homeodomain-like
SMARTSM007178.7E-9163213IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.7E-12166213IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.5E-9166213IPR009057Homeodomain-like
CDDcd001678.11E-8167211No hitNo description
PfamPF002495.5E-9167210IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MDPLFSTTEE WSSSDIALVK SLIVMHNTNN TNKKNIIGGD GDDTKNNKHE DIVDVLHAQF  60
PWKDRHQVVD LYVDVMVEMI QCQELITTAT NNGPMAEEAG TDLVMSNVGM VVEDTTSMDD  120
IEIVHGSDLN VVDARRAAKK NTAEKQQPPK QQRHDHQPKR QATTRFWTTK EHRLFLRGLS  180
VYGRGKWKDI SRYFVKTRTA VQVSSHAQKY FRRKENPNTR QRYSINDVGL YDAEPWAVPN  240
NSYDGFEDDL AFPGAGGSNY NSNSYYNDHG GQQGSTTQHL PTARPAARPA GQSRRYSLCL  300
STVDVVSQST AGERDASAAS SPSLSAVVAS ALSRRAASTI SRMDRRKSSV VILRRRRAAA  360
FVVGYSGSRA ELERLEIDSE SAVVIIVFVL SAAAGSSGSA ASAEWVRGCI HPDRNDDDDE  420
DGDLSMLVLE RPPPWSFLRA LDKCRNDLCS PACFLLLTGS SSFMAMAPFS SSMF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1344356RRKSSVVILRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10580.29e-19MYB_related family protein